SERCA1/ATP2A1 Rabbit monoclonal antibody

Size

POA

SKU:: A19639
Additional Names:: ATP2A|SERCA1|SERCA1/ATP2A1
Application:: ELISA, WB, IF
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLEDPEDERRK
Uniprot:: O14983
Synonyms:: ATP2A;ATPase, Ca++ transporting, cardiac muscle, fast twitch 1;calcium pump 1;Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform;endoplasmic reticulum class 1/2 Ca(2+) ATPase;sarcoplasmic/endoplasmic reticulum calcium ATPase 1;SERCA1;SR Ca(2+)-ATPase 1
Extra Details:: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in three transcript variants encoding different isoforms.