A19621
ABCF1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19621
- Additional Names:
- ABC27|ABC50|ABCF1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 120kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMVSRPRE
- Uniprot:
- Q8NE71
- Synonyms:
- ABC27;ABC50;ATP-binding cassette 50;ATP-binding cassette 50 (TNF-alpha stimulated);ATP-binding cassette sub-family F member 1;ATP-binding cassette, sub-family F (GCN20), member 1;TNF-alpha-stimulated ABC protein;TNFalpha-inducible ATP-binding protein
- Extra Details:
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process.
- Shipping Conditions:
- Blue Ice