TACC3 Rabbit monoclonal antibody

Size

POA

SKU:: A19617
Additional Names:: ERIC-1|ERIC1|maskin|TACC3|Tacc4
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 140 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
Uniprot:: Q9Y6A5
Synonyms:: ERIC-1;ERIC1;maskin;Tacc4;transforming acidic coiled-coil-containing protein 3
Extra Details:: TACC3, also known as ERIC 1, belongs to the TACC family. TACC family members TACC1, TACC2, and TACC3 map very closely to the corresponding FGFR1, FGFR2, FGFR3 genes on chromosomes 8, 10, and 4. Subsequently, since they are phylogenetically related, it is proposed that TACC and FGFR have similar roles in cell growth and differentiation. It plays a role in the microtubule-dependent coupling of the nucleus and the centrosome and involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors.