A19613
EBI3 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19613
- Additional Names:
- EBI3|IL-27B|IL27B|IL35B
- Application:
- ELISA, WB
- Molecular Weight:
- 31kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
- Uniprot:
- Q14213
- Synonyms:
- cytokine receptor;EBV-induced gene 3 protein;Epstein-Barr virus induced gene 3;epstein-Barr virus-induced gene 3 protein;IL-27 subunit beta;IL-27B;IL27 subunit;IL27B;IL35 subunit;IL35B;interleukin-27 subunit beta
- Extra Details:
- This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.
- Shipping Conditions:
- Blue Ice