A19608
PAK1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A19608
- Additional Names:
- alpha-PAK|IDDMSSD|p65-PAK|PAK1|PAKalpha
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 61-68kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMP
- Uniprot:
- Q13153
- Synonyms:
- alpha-PAK;IDDMSSD;p21 protein (Cdc42/Rac)-activated kinase 1;p21-activated kinase 1;p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast);p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related);p65-PAK;PAKalpha;serine/threonine-protein kinase PAK 1;STE20 homolog, yeast
- Extra Details:
- This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Mutations in this gene have been associated with macrocephaly, seizures, and speech delay. Overexpression of this gene is also reported in many cancer types, and particularly in breast cancer. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice



