[KD Validated] ATG7 Rabbit monoclonal antibody

Size

POA

SKU:: A19604
Additional Names:: [KD Validated] ATG7|GSA7
Application:: ELISA, WB, IHC-P, IP
Molecular Weight:: 78 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Uniprot:: O95352
Synonyms:: APG7 autophagy 7-like;APG7-LIKE;APG7L;ATG12-activating enzyme E1 ATG7;Autophagy-related protein 7;GSA7;hAGP7;SCAR31;ubiquitin-activating enzyme E1-like protein;ubiquitin-like modifier-activating enzyme ATG7
Extra Details:: This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.