USP14 Rabbit monoclonal antibody

Size

POA

SKU:: A19589
Additional Names:: TGT|Ubp6|USP14
Application:: ELISA, WB, IP
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWH
Uniprot:: P54578
Synonyms:: deubiquitinating enzyme 14;TGT;tRNA-guanine transglycosylase, 60-kD subunit;ubiquitin carboxyl-terminal hydrolase 14;ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase);ubiquitin specific protease 14 (tRNA-guanine transglycosylase);ubiquitin thioesterase 14;ubiquitin thiolesterase 14;ubiquitin-specific processing protease 14;Ubiquitin-specific-processing protease 14
Extra Details:: This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Shipping Conditions:: Blue Ice