HDAC1 Rabbit monoclonal antibody

Size

POA

SKU:: A19571
Additional Names:: C1|GON-10|HD1|KDAC1|RPD3|RPD3L1
Application:: ELISA, IHC-P, IF, ICC
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKE
Uniprot:: Q13547
Synonyms:: GON-10;HD1;histone deacetylase 1;KDAC1;reduced potassium dependency, yeast homolog-like 1;RPD3;RPD3L1
Extra Details:: Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis.