RARA Alpha Rabbit monoclonal antibody

Size

POA

SKU:: A19551
Additional Names:: NR1B1|RAR|RARalpha|RARA Alpha
Application:: ELISA, WB, IHC-P
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHY
Uniprot:: P10276
Synonyms:: NR1B1;nuclear receptor subfamily 1 group B member 1;nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form;PML-DDX5-RARA fusion;PML-DDX5-RARA fusion protein;RAR;RAR-alpha;retinoic acid nuclear receptor alpha variant 1;retinoic acid nuclear receptor alpha variant 2;retinoic acid receptor alpha;retinoic acid receptor, alpha polypeptide
Extra Details:: This gene represents a nuclear retinoic acid receptor. The encoded protein, retinoic acid receptor alpha, regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia. Alternatively spliced transcript variants have been found for this locus.