A19541
5T4 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19541
- Additional Names:
- 5T4|5T4AG|M6P1|WAIF1
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV
- Uniprot:
- Q13641
- Synonyms:
- 5T4;5T4 oncofetal antigen;5T4 oncofetal trophoblast glycoprotein;5T4 oncotrophoblast glycoprotein;5T4AG;M6P1;trophoblast glycoprotein;WAIF1;wnt-activated inhibitory factor 1
- Extra Details:
- This gene encodes a leucine-rich transmembrane glycoprotein that may be involved in cell adhesion. The encoded protein is an oncofetal antigen that is specific to trophoblast cells. In adults this protein is highly expressed in many tumor cells and is associated with poor clinical outcome in numerous cancers. Alternate splicing in the 5' UTR results in multiple transcript variants that encode the same protein.
- Shipping Conditions:
- Blue Ice