Aurora B Rabbit monoclonal antibody

Size

POA

SKU:: A19539
Additional Names:: AIK2|AIM-1|AIM1|ARK-2|ARK2|AurB|aurkb-sv1|aurkb-sv2|Aurora B|IPL1|PPP1R48|STK-1|STK12|STK5
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 39kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH
Uniprot:: Q96GD4
Synonyms:: AIK2;AIM-1;AIM1;ARK-2;ARK2;AurB;aurkb-sv1;aurkb-sv2;Aurora 1;aurora kinase B;aurora kinase B-Sv1;aurora kinase B-Sv2;aurora- and Ipl1-like midbody-associated protein 1;aurora-1;aurora-B;aurora-related kinase 2;aurora/IPL1-related kinase 2;IPL1;PPP1R48;protein phosphatase 1, regulatory subunit 48;serine/threonine kinase 12;serine/threonine-protein kinase 12;serine/threonine-protein kinase 5;serine/threonine-protein kinase aurora-B;STK-1;STK12;STK5
Extra Details:: This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene.

Shipping Conditions:: Blue Ice