A19517
SHOX Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A19517
- Additional Names:
- GCFX|PHOG|SHOX|SHOXY|SS
- Application:
- ELISA, WB
- Molecular Weight:
- 32kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDED
- Uniprot:
- O15266
- Synonyms:
- GCFX;growth control factor, X-linked;PHOG;pseudoautosomal homeobox-containing osteogenic protein;short stature homeobox protein;Short stature homeobox-containing protein;SHOXY;SS
- Extra Details:
- This gene belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
- Shipping Conditions:
- Blue Ice



