Smad5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1947
Additional Names:: DWFC|JV5-1|MADH5|Smad5
Application:: ELISA, WB, IHC-P
Molecular Weight:: 52kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
Uniprot:: Q99717
Synonyms:: DWFC;JV5-1;MAD, mothers against decapentaplegic homolog 5;MADH5;mothers against decapentaplegic homolog 5;mothers against decapentaplegic, drosophila, homolog of, 5;SMA- and MAD-related protein 5;SMAD family member 5;SMAD, mothers against DPP homolog 5
Extra Details:: The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants.