A19437
EI24 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A19437
- Additional Names:
- EI24|EPG4|PIG8|TP53I8
- Application:
- ELISA, WB
- Molecular Weight:
- 32kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH
- Uniprot:
- O14681
- Synonyms:
- ectopic P-granules autophagy protein 4 homolog;EPG4;etoposide induced 2.4;etoposide-induced protein 2.4 homolog;p53-induced gene 8 protein;PIG8;TP53I8;tumor protein p53 inducible protein 8
- Extra Details:
- This gene encodes a putative tumor suppressor and has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The encoded protein may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, 7, and 8.
- Shipping Conditions:
- Blue Ice