A1938
CD3G Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1938
- Additional Names:
- CD3-GAMMA|CD3G|CD3GAMMA|IMD17|T3G
- Application:
- ELISA, WB
- Molecular Weight:
- 18-28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
- Uniprot:
- P09693
- Synonyms:
- CD3-GAMMA;CD3g antigen, gamma polypeptide (TiT3 complex);CD3g molecule, epsilon (CD3-TCR complex);CD3g molecule, gamma (CD3-TCR complex);IMD17;T-cell antigen receptor complex, gamma subunit of T3;T-cell receptor T3 gamma chain;T-cell surface glycoprotein CD3 gamma chain;T3G
- Extra Details:
- The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.
- Shipping Conditions:
- Blue Ice

