GTF2F1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A19315
Additional Names:: BTF4|GTF2F1|RAP74|TF2F1|TFIIF
Application:: ELISA, WB
Molecular Weight:: 74kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: PSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Uniprot:: P35269
Synonyms:: BTF4;general transcription factor IIF 74 kDa subunit;general transcription factor IIF subunit 1;general transcription factor IIF, polypeptide 1, 74kDa;RAP74;TF2F1;TFIIF;TFIIF-alpha;transcription initiation factor IIF subunit alpha;transcription initiation factor RAP74
Extra Details:: Enables several functions, including RNA polymerase II general transcription initiation factor activity; phosphatase activator activity; and promoter-specific chromatin binding activity. Involved in several processes, including positive regulation of transcription by RNA polymerase II; response to virus; and transcription initiation from RNA polymerase II promoter. Located in cell junction and nucleoplasm. Part of transcription factor TFIID complex.