GNA11 Rabbit polyclonal antibody

Size

£152.00

SKU:: A19313
Additional Names:: FBH|FBH2|FHH2|GNA-11|GNA11|HG1K|HHC2|HYPOC2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 42kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ
Uniprot:: P29992
Synonyms:: FBH;FBH2;FHH2;g alpha-11;GNA-11;guanine nucleotide binding protein (G protein), alpha 11 (Gq class);guanine nucleotide-binding protein G(y) subunit alpha;guanine nucleotide-binding protein subunit alpha-11;HHC2;HYPOC2
Extra Details:: The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations.