Caspase-4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A19305
Additional Names:: Caspase-4|ICE(rel)II|ICEREL-II|ICH-2|Mih1|Mih1/TX|TX
Application:: ELISA, WB, IHC-P
Molecular Weight:: 43kDa
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: QISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRD
Uniprot:: P49662
Synonyms:: apoptotic cysteine protease Mih1/TX;CASP-4;caspase 4, apoptosis-related cysteine peptidase;caspase 4, apoptosis-related cysteine protease;caspase-4;caspase-4 isoform alpha;ICE and Ced-3 homolog 2;ICE(rel)-II;ICE(rel)II;ICEREL-II;ICH-2;Mih1;Mih1/TX;protease ICH-2;protease TX;TX
Extra Details:: This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.

Shipping Conditions:: Blue Ice