A19305
Caspase-4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A19305
- Additional Names:
- Caspase-4|ICE(rel)II|ICEREL-II|ICH-2|Mih1|Mih1/TX|TX
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 43kDa
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- QISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRD
- Uniprot:
- P49662
- Synonyms:
- apoptotic cysteine protease Mih1/TX;CASP-4;caspase 4, apoptosis-related cysteine peptidase;caspase 4, apoptosis-related cysteine protease;caspase-4;caspase-4 isoform alpha;ICE and Ced-3 homolog 2;ICE(rel)-II;ICE(rel)II;ICEREL-II;ICH-2;Mih1;Mih1/TX;protease ICH-2;protease TX;TX
- Extra Details:
- This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.
- Shipping Conditions:
- Blue Ice





_WB_01.jpg)
_IHC_01.jpg)
_IHC_02.jpg)