A19300
ICAM-1/CD54 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19300
- Additional Names:
- BB2|CD54|ICAM-1/CD54|MALA2|MyD10|P3.58
- Application:
- ELISA, Flow Cytometry, WB, IHC-P
- Molecular Weight:
- 82-100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQ
- Uniprot:
- P05362
- Synonyms:
- BB2;CD54;cell surface glycoprotein P3.58;epididymis secretory sperm binding protein;ICAM-1;intercellular adhesion molecule 1;intercellular adhesion molecule 1 (CD54), human rhinovirus receptor;major group rhinovirus receptor;P3.58
- Extra Details:
- This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.
- Shipping Conditions:
- Blue Ice