Steroidogenic factor-1 (SF-1/NR5A1) Rabbit monoclonal antibody

Size

POA

SKU:: A19277
Additional Names:: AD4BP|ELP|FTZ1|FTZF1|hSF-1|POF7|SF-1|SF1|SPGF8|SRXX4|SRXY3|Steroidogenic factor-1 (SF-1/NR5A1)
Application:: ELISA, WB
Molecular Weight:: 48kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Uniprot:: Q13285
Synonyms:: AD4BP;adrenal 4 binding protein;Adrenal 4-binding protein;ELP;FTZ1;FTZF1;fushi tarazu factor homolog 1;hSF-1;nuclear receptor AdBP4;Nuclear receptor subfamily 5 group A member 1;POF7;SF-1;SF1;SPGF8;SRXX4;SRXY3;steroid hormone receptor Ad4BP;steroidogenic factor 1;steroidogenic factor 1 nuclear receptor;steroidogenic factor-1;STF-1
Extra Details:: The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.