A1927
TNNC1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1927
- Additional Names:
- CMD1Z|CMH13|TN-C|TNC|TNNC|TNNC1
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 18kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV
- Uniprot:
- P63316
- Synonyms:
- cardiac troponin C;CMD1Z;CMH13;slow twitch skeletal/cardiac muscle troponin C;TN-C;TNC;TNNC;troponin C type 1 (slow);troponin C, slow skeletal and cardiac muscles
- Extra Details:
- Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z.
- Shipping Conditions:
- Blue Ice



