A19269
AP1G1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19269
- Additional Names:
- ADTG|AP1G1|CLAPG1|USRISD
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
- Uniprot:
- O43747
- Synonyms:
- adapter-related protein complex 1 subunit gamma-1;adaptor protein complex AP-1 subunit gamma-1;adaptor related protein complex 1 gamma 1 subunit;Adaptor-related protein complex 1 subunit gamma-1;ADTG;AP-1 complex subunit gamma-1;CLAPG1;clathrin assembly protein complex 1 gamma large chain;clathrin assembly protein complex 1 gamma-1 large chain;clathrin-associated/assembly/adaptor protein, large, gamma 1;gamma adaptin;gamma1-adaptin;golgi adaptor HA1/AP1 adaptin gamma subunit;golgi adaptor HA1/AP1 adaptin subunit gamma-1;testicular tissue protein Li 21
- Extra Details:
- Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice