LHX2 Rabbit monoclonal antibody

Size

POA

SKU:: A19265
Additional Names:: hLhx2|LH2|LHX2
Application:: ELISA, WB
Molecular Weight:: 44 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSI
Uniprot:: P50458
Synonyms:: hLhx2;homeobox protein LH-2;LH2;LIM homeobox protein 2;LIM HOX gene 2;LIM/homeobox protein Lhx2
Extra Details:: This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution.