A19259
SERPING1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19259
- Additional Names:
- C1IN|C1INH|C1NH|HAE1|HAE2|SERPING1
- Application:
- ELISA, WB
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRV
- Uniprot:
- P05155
- Synonyms:
- C1 esterase inhibitor;C1-inhibiting factor;C1-inhibitor;C1IN;C1INH;C1NH;complement component 1 inhibitor;epididymis secretory sperm binding protein;HAE1;HAE2;plasma protease C1 inhibitor;serine/cysteine proteinase inhibitor clade G member 1;serpin G1;serpin peptidase inhibitor clade G member 1;serpin peptidase inhibitor, clade G (C1 inhibitor), member 1
- Extra Details:
- This gene encodes a highly glycosylated plasma protein involved in the regulation of the complement cascade. Its encoded protein, C1 inhibitor, inhibits activated C1r and C1s of the first complement component and thus regulates complement activation. It is synthesized in the liver, and its deficiency is associated with hereditary angioneurotic oedema (HANE). Alternative splicing results in multiple transcript variants encoding the same isoform.
- Shipping Conditions:
- Blue Ice