A19252
PLA2G2A Rabbit monoclonal antibody

Size
POA
- SKU:
- A19252
- Additional Names:
- MOM1|PLA2|PLA2B|PLA2G2A|PLA2L|PLA2S|PLAS1|sPLA2
- Application:
- ELISA, WB
- Molecular Weight:
- 15 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC
- Uniprot:
- P14555
- Synonyms:
- GIIC sPLA2;group IIA phospholipase A2;MOM1;non-pancreatic secretory phospholipase A2;NPS-PLA2;phosphatidylcholine 2-acylhydrolase 2A;phospholipase A2, group IIA (platelets, synovial fluid);phospholipase A2, membrane associated;PLA2;PLA2B;PLA2L;PLA2S;PLAS1;sPLA2
- Extra Details:
- The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.
- Shipping Conditions:
- Blue Ice



