CHMP2B Rabbit monoclonal antibody

Size

POA

SKU:: A19244
Additional Names:: ALS17|CHMP2.5|CHMP2B|DMT1|FTDALS7|VPS2-2|VPS2B
Application:: ELISA, WB, IHC-P
Molecular Weight:: 28kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
Uniprot:: Q9UQN3
Synonyms:: ALS17;charged multivesicular body protein 2b;CHMP2.5;chromatin modifying protein 2B;Chromatin-modifying protein 2b;DMT1;FTDALS7;Vacuolar protein sorting-associated protein 2-2;vacuolar protein-sorting-associated protein 2-2;VPS2 homolog B;VPS2-2;VPS2B
Extra Details:: This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration.