A19240
VPS28 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19240
- Additional Names:
- ESCRT-I subunit|VPS28
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 25kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
- Uniprot:
- Q9UK41
- Synonyms:
- ESCRT-I complex subunit VPS28;vacuolar protein sorting 28 homolog;vacuolar protein sorting 28-like protein;vacuolar protein sorting-associated protein 28 homolog;VPS28, ESCRT-I subunit;yeast class E protein Vps28p homolog
- Extra Details:
- This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice