A19235
TROY/TNFRSF19 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19235
- Additional Names:
- TAJ|TAJ-alpha|TRADE|TROY|TROY/TNFRSF19
- Application:
- ELISA, WB
- Molecular Weight:
- 46kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK
- Uniprot:
- Q9NS68
- Synonyms:
- TAJ;TAJ-alpha;toxicity and JNK inducer;TRADE;TROY;tumor necrosis factor receptor superfamily member 19
- Extra Details:
- The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described.
- Shipping Conditions:
- Blue Ice