LGI1 Rabbit monoclonal antibody

Size

POA

SKU:: A19230
Additional Names:: ADLTE|ADPAEF|ADPEAF|EPITEMPIN|EPT|ETL1|IB1099|LGI1
Application:: ELISA, WB
Molecular Weight:: 64kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYV
Uniprot:: O95970
Synonyms:: ADLTE;ADPAEF;ADPEAF;EPITEMPIN;epitempin-1;EPT;ETL1;IB1099;leucine-rich glioma-inactivated protein 1
Extra Details:: This gene encodes a member of the secreted leucine-rich repeat (LRR) superfamily and shares homology with members of the SLIT protein family. The encoded protein may regulate the activity of voltage-gated potassium channels and may be involved in neuronal growth regulation and cell survival. This gene is rearranged as a result of translocations in glioblastoma cell lines, and it is frequently down-regulated or rearranged in malignant gliomas. Mutations in this gene result in autosomal dominant lateral temporal epilepsy. Alternative splicing results in multiple transcript variants.