A1917
KCNQ2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1917
- Additional Names:
- BFNC|DEE7|EBN|EBN1|ENB1|HNSPC|KCNA11|KCNQ2|KV7.2
- Application:
- ELISA, WB
- Molecular Weight:
- 95kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SPSADQSLEDSPSKVPKSWSFGDRSRARQAFRIKGAASRQNSEEASLPGEDIVDDKSCPCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRVDQIVGRGPAITDKDRTKGPAEAELPEDPSMMGRLGKVEKQVLSMEKKLDFLVNIYMQRMGIPPTETEAYFGAKEPE
- Uniprot:
- O43526
- Synonyms:
- BFNC;DEE7;EBN;EBN1;ENB1;HNSPC;KCNA11;KQT-like 2;KV7.2;neuroblastoma-specific potassium channel subunit alpha KvLQT2;potassium channel, voltage gated KQT-like subfamily Q, member 2;potassium voltage-gated channel subfamily KQT member 2;voltage-gated potassium channel subunit Kv7.2
- Extra Details:
- The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by this gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in this gene are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1). At least five transcript variants encoding five different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice