VEGFR1 Rabbit monoclonal antibody

Size

POA

SKU:: A19132
Additional Names:: FLT|FLT-1|FRT|VEGFR-1|VEGFR1
Application:: ELISA, WB
Molecular Weight:: 180kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN
Uniprot:: P17948
Synonyms:: FLT;FLT-1;fms related tyrosine kinase 1;fms-like tyrosine kinase 1;fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor);tyrosine-protein kinase FRT;tyrosine-protein kinase receptor FLT;vascular endothelial growth factor receptor 1;vascular permeability factor receptor;VEGFR-1;VEGFR1
Extra Details:: This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Shipping Conditions:: Blue Ice