VCAM1 Rabbit PolymAb[R]

Size

POA

SKU:: A19131PM
Additional Names:: CD106|INCAM-100
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 110 kDa
Species Reactivity:: Human, Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV
Uniprot:: P19320, P29533
Synonyms:: CD106;CD106 antigen;INCAM-100;V-CAM 1;vascular cell adhesion protein 1;Vcam;Vcam-1
Extra Details:: This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.