Transferrin Rabbit monoclonal antibody

Size

POA

SKU:: A19130
Additional Names:: HEL-S-71p|PRO1557|PRO2086|TFQTL1|Transferrin
Application:: ELISA, WB, IHC-P
Molecular Weight:: 77kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIP
Uniprot:: P02787
Synonyms:: beta-1 metal-binding globulin;epididymis secretory sperm binding protein Li 71p;HEL-S-71p;PRO1557;PRO2086;serotransferrin;siderophilin;TFQTL1
Extra Details:: This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum.