Lamin B1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1910
Additional Names:: ADLD|Lamin B1|LMN|LMN2|LMNB|MCPH26
Application:: ChIP, ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 68kDa/45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
Uniprot:: P20700
Synonyms:: ADLD;lamin-B1;LMN;LMN2;LMNB;MCPH26
Extra Details:: This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.