[KO Validated] N-Cadherin Rabbit monoclonal antibody

Size

POA

SKU:: A19083
Additional Names:: ACOGS|ADHD8|ARVD14|CD325|CDHN|CDw325|in|NCAD
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 140 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP
Uniprot:: P19022
Synonyms:: ACOGS;ARVD14;cadherin 2, type 1, N-cadherin (neuronal);cadherin-2;calcium-dependent adhesion protein, neuronal;CD325;CDHN;CDw325;N-cadherin 1;NCAD;neural cadherin
Extra Details:: This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.