[KO Validated] MyD88 Rabbit monoclonal antibody

Size

POA

SKU:: A19082
Additional Names:: 88|IMD68|MYD88D|WM1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 33 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL
Uniprot:: Q99836
Synonyms:: IMD68;mutant myeloid differentiation primary response 88;MYD88D;myeloid differentiation primary response 88;myeloid differentiation primary response gene (88);myeloid differentiation primary response protein MyD88
Extra Details:: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.