HOXA9 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1908
Additional Names:: ABD-B|HOX1|HOX1.7|HOX1G|HOXA9
Application:: ELISA, WB
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPP
Uniprot:: P31269
Synonyms:: ABD-B;homeobox protein Hox-1G;homeobox protein Hox-A9;homeodomain protein HOXA9;HOX1;HOX1.7;HOX1G
Extra Details:: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Read-through transcription exists between this gene and the upstream homeobox A10 (HOXA10) gene.

Shipping Conditions:: Blue Ice