[KO Validated] MEK2 Rabbit monoclonal antibody

Size

POA

SKU:: A19078
Additional Names:: [KO/KD Validated] MEK2|CFC4|MAPKK2|MEK2|MKK2|PRKMK2
Application:: ELISA, WB
Molecular Weight:: 44kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMAR
Uniprot:: P36507
Synonyms:: CFC4;dual specificity mitogen-activated protein kinase kinase 2;ERK activator kinase 2;MAP kinase kinase 2;MAPK/ERK kinase 2;MAPKK2;MEK2;mitogen-activated protein kinase kinase 2, p45;MKK2;PRKMK2
Extra Details:: The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, cognitive disability, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.

Shipping Conditions:: Blue Ice