A19049
FADD Rabbit monoclonal antibody

Size
POA
- SKU:
- A19049
- Additional Names:
- FADD|GIG3|IMD90|MORT1
- Application:
- ELISA, WB
- Molecular Weight:
- 25kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN
- Uniprot:
- Q13158
- Synonyms:
- Fas (TNFRSF6)-associated via death domain;FAS-associated death domain protein;Fas-associating death domain-containing protein;Fas-associating protein with death domain;GIG3;growth-inhibiting gene 3 protein;Mediator of receptor induced toxicity;mediator of receptor-induced toxicity;MORT1;Protein FADD
- Extra Details:
- The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development.
- Shipping Conditions:
- Blue Ice

