A19023
CD63 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19023
- Additional Names:
- CD63|LAMP-3|ME491|MLA1|OMA81H|TSPAN30
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 25-63kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
- Uniprot:
- P08962
- Synonyms:
- CD63 antigen;CD63 antigen (melanoma 1 antigen);granulophysin;LAMP-3;lysosomal-associated membrane protein 3;lysosome-associated membrane glycoprotein 3;ME491;melanoma-associated antigen ME491;melanoma-associated antigen MLA1;MLA1;ocular melanoma-associated antigen;OMA81H;tetraspanin-30;tspan-30;TSPAN30
- Extra Details:
- The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.
- Shipping Conditions:
- Blue Ice