A19022
CD46 Rabbit monoclonal antibody

Size
POA
- SKU:
- A19022
- Additional Names:
- AHUS2|CD46|MCP|MIC10|TLX|TRA2.10
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 45-75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCP
- Uniprot:
- P15529
- Synonyms:
- AHUS2;antigen identified by monoclonal antibody TRA-2-10;CD46 antigen, complement regulatory protein;CD46 molecule, complement regulatory protein;complement membrane cofactor protein;MCP;measles virus receptor;membrane cofactor protein;membrane cofactor protein (CD46, trophoblast-lymphocyte cross-reactive antigen);MIC10;TLX;TRA2.10;trophoblast leucocyte common antigen;trophoblast leukocyte common antigen;trophoblast-lymphocyte cross-reactive antigen
- Extra Details:
- The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. The encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice



