[KO Validated] A Alpha-Catenin Rabbit monoclonal antibody

Size

POA

SKU:: A19004
Additional Names:: CAP102|in|MDBS2|MDPT2
Application:: ELISA, WB
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQ
Uniprot:: P35221
Synonyms:: Alpha E-catenin;alpha-E-catenin;Cadherin-associated protein;CAP102;catenin (cadherin-associated protein), alpha 1, 102kDa;catenin alpha-1;epididymis secretory sperm binding protein;MDPT2;renal carcinoma antigen NY-REN-13
Extra Details:: This gene encodes a member of the catenin family of proteins that play an important role in cell adhesion process by connecting cadherins located on the plasma membrane to the actin filaments inside the cell. The encoded mechanosensing protein contains three vinculin homology domains and undergoes conformational changes in response to cytoskeletal tension, resulting in the reconfiguration of cadherin-actin filament connections. Certain mutations in this gene cause butterfly-shaped pigment dystrophy.