A1897
SLPI Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1897
- Additional Names:
- ALK1|ALP|BLPI|HUSI|HUSI-I|MPI|SLPI|WAP4|WFDC4
- Application:
- ELISA, WB
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
- Uniprot:
- P03973
- Synonyms:
- ALK1;ALP;antileukoproteinase;BLPI;HUSI;HUSI-1;HUSI-I;MPI;mucus proteinase inhibitor;protease inhibitor WAP4;Secretory leukocyte protease inhibitor;secretory leukocyte protease inhibitor (antileukoproteinase);seminal proteinase inhibitor;WAP four-disulfide core domain protein 4;WAP4;WFDC4
- Extra Details:
- This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity.
- Shipping Conditions:
- Blue Ice