A1896
CCL21 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1896
- Additional Names:
- 6Ckine|CCL21|CKb9|ECL|SCYA21|SLC|TCA4
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 15kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
- Uniprot:
- O00585
- Synonyms:
- 6Ckine;beta chemokine exodus-2;Beta-chemokine exodus-2;C-C motif chemokine 21;chemokine (C-C motif) ligand 21;CKb9;ECL;Efficient Chemoattractant for Lymphocytes;SCYA21;secondary lymphoid tissue chemokine;Secondary lymphoid-tissue chemokine;SLC;small inducible cytokine subfamily A (Cys-Cys), member 21;Small-inducible cytokine A21;TCA4
- Extra Details:
- This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19).
- Shipping Conditions:
- Blue Ice





