CADM1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1892
Additional Names:: BL2|CADM1|IGSF4|IGSF4A|Necl-2|NECL2|RA175|sgIGSF|ST17|sTSLC-1|SYNCAM|synCAM1|TSLC1
Application:: ELISA, WB
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTT
Uniprot:: Q9BY67
Synonyms:: BL2;cell adhesion molecule 1;IGSF4;IGSF4A;immunoglobulin superfamily member 4;immunoglobulin superfamily, member 4D variant 1;immunoglobulin superfamily, member 4D variant 2;Necl-2;NECL2;nectin-like 2;nectin-like protein 2;RA175;sgIGSF;spermatogenic immunoglobulin superfamily;ST17;sTSLC-1;synaptic cell adhesion molecule;SYNCAM;synCAM1;truncated CADM1 protein;TSLC-1;TSLC1;TSLC1/Nectin-like 2/IGSF4;tumor suppressor in lung cancer 1
Extra Details:: Enables signaling receptor binding activity. Involved in several processes, including cell recognition; positive regulation of cytokine production; and susceptibility to natural killer cell mediated cytotoxicity. Located in plasma membrane. Implicated in breast carcinoma and prostate cancer. Biomarker of cervix uteri carcinoma in situ.

Shipping Conditions:: Blue Ice