A18863
SHH Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18863
- Additional Names:
- 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081|SHH|ShhNC
- Application:
- ELISA, WB
- Molecular Weight:
- 45kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- KAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLTFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDS
- Uniprot:
- Q62226
- Synonyms:
- 9530036O11Rik;Dsh;hemimelic extra toes;HHG-1;Hhg1;Hx;Hxl3;M100081;shh unprocessed N-terminal signaling and C-terminal autoprocessing domains;ShhNC;short digits;sonic hedgehog protein
- Extra Details:
- Enables glycosaminoglycan binding activity; laminin-1 binding activity; and patched binding activity. Involved in several processes, including hematopoietic or lymphoid organ development; positive regulation of T cell activation; and regulation of smooth muscle cell differentiation. Acts upstream of or within several processes, including animal organ development; limb morphogenesis; and neurogenesis. Located in several cellular components, including cell surface; extracellular space; and membrane raft. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; limb bud; and sensory organ. Used to study brachydactyly type A1 and holoprosencephaly 3. Human ortholog(s) of this gene implicated in several diseases, including Hirschsprung's disease; holoprosencephaly (multiple); hypoplastic or aplastic tibia with polydactyly; middle cerebral artery infarction; and polydactyly. Orthologous to human SHH (sonic hedgehog signaling molecule).
- Shipping Conditions:
- Blue Ice