A1886
IL12RB1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1886
- Additional Names:
- CD212|IL-12R-BETA1|IL12RB|IL12RB1|IMD30
- Application:
- ELISA, WB
- Molecular Weight:
- 102kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGK
- Uniprot:
- P42701
- Synonyms:
- CD212;cluster of differentiation 212;IL-12 receptor beta component;IL-12 receptor subunit beta-1;IL-12R subunit beta-1;IL-12R-BETA1;IL12RB;IMD30;interleukin 12 receptor, beta 1;interleukin-12 receptor beta-1 chain;interleukin-12 receptor subunit beta-1
- Extra Details:
- The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. Mutations in this gene impair the development of interleukin-17-producing T lymphocytes and result in increased susceptibility to mycobacterial and Salmonella infections. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice