SOX17 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18858
Additional Names:: SOX17|VUR3
Application:: ELISA, WB
Molecular Weight:: 50 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: RDGTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYCNYPDV
Uniprot:: Q9H6I2
Synonyms:: SRY (sex determining region Y)-box 17;SRY-box 17;SRY-related HMG-box transcription factor SOX17;transcription factor SOX-17;VUR3
Extra Details:: This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.