A18853
UCP1 Rabbit polyclonal antibody
Size
POA
- SKU:
- A18853
- Additional Names:
- Mitochondrial brown fat uncoupling protein 1
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Porcine
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YDTVQEFFTTGKEASLGSKISAGLMTGGVAVFIGQPTEVVKVRLQAQSHLHGPKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLTRNVIINCTELVTYDLM
- Uniprot:
- P10861
- Synonyms:
- mitochondrial brown fat uncoupling protein 1;mitochondrial, proton carrier;SLC25A7;solute carrier family 25 member 7;thermogenin;UCP;UCP 1;uncoupling protein 1 (mitochondrial, proton carrier)
- Extra Details:
- Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.
- Shipping Conditions:
- Blue Ice