TRRAP Rabbit polyclonal antibody

Size

£152.00

SKU:: A18849
Additional Names:: DEDDFA|DFNA75|PAF350/400|PAF400|STAF40|TR-AP|Tra1|TRRAP
Application:: ELISA, WB, IHC-P
Molecular Weight:: 434kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: PNATDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIGVSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLDNLCRMDPAWHPWL
Uniprot:: Q9Y4A5
Synonyms:: 350/400 kDa PCAF-associated factor;DEDDFA;DFNA75;PAF350/400;PAF400;STAF40;TR-AP;Tra1;tra1 homolog;transformation/transcription domain-associated protein
Extra Details:: This gene encodes a large multidomain protein of the phosphoinositide 3-kinase-related kinases (PIKK) family. The encoded protein is a common component of many histone acetyltransferase (HAT) complexes and plays a role in transcription and DNA repair by recruiting HAT complexes to chromatin. Deregulation of this gene may play a role in several types of cancer including glioblastoma multiforme. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.